PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc07_g15130
Common NameGSCOC_T00036515001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family CAMTA
Protein Properties Length: 64aa    MW: 7304.48 Da    PI: 8.5099
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc07_g15130genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1283.9e-092055237
         CG-1  2 lkekkrwlkneeiaaiLenfekheltlelktrpksg 37
                 ++ ++rwl++ ei++iL n++k++++ e+++rp+s 
  Cc07_g15130 20 VEAQHRWLRPAEICEILRNYQKFRIAPEPPNRPPSM 55
                 6679*****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143720.5471563IPR005559CG-1 DNA-binding domain
PfamPF038592.7E-72155IPR005559CG-1 DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 64 aa     Download sequence    Send to blast
MAESRRYALG AQLDIEQILV EAQHRWLRPA EICEILRNYQ KFRIAPEPPN RPPSMIILSS  60
SSL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016550150.14e-29PREDICTED: calmodulin-binding transcription activator 3-like isoform X1
RefseqXP_016550151.14e-29PREDICTED: calmodulin-binding transcription activator 3-like isoform X2
SwissprotQ6NPP43e-22CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLA0A068TYW23e-39A0A068TYW2_COFCA; Uncharacterized protein
STRINGSolyc04g056270.2.14e-28(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14489811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.27e-21Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains